DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and CG43055

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001245867.1 Gene:CG43055 / 12798556 FlyBaseID:FBgn0262357 Length:180 Species:Drosophila melanogaster


Alignment Length:132 Identity:34/132 - (25%)
Similarity:56/132 - (42%) Gaps:11/132 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GKCFYVGIKKI--NWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFWFGGNDLQSEG 104
            |..:|....|:  ||:.|...|.:...:|......::.|.:.||:........:|..|.||..:.
  Fly    46 GDSYYFIENKLDRNWYDAFEACRQMNADLVAFEDRKEQKLIYHYLVDNEMDTTYWTAGTDLAEQD 110

  Fly   105 RFKYISSGKLVRYMGDSNI---VEPTQRSNLDDCLEIR-IRPNVTVVL-DVNCQEKKYFICEQNQ 164
            .|.:.|:|:.|.    |::   .||....|.:.|:|.: :.|...:.| |..|..|..:||...|
  Fly   111 SFVWFSNGQPVA----SDLWCNNEPNNAKNEEHCVEYKPLHPEAKMGLNDRVCTFKTGYICRAPQ 171

  Fly   165 MK 166
            .|
  Fly   172 PK 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 31/125 (25%)
CG43055NP_001245867.1 CLECT 49..167 CDD:153057 29/121 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 1 1.000 - - FOG0001931
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.