DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and Asgr1

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001278060.1 Gene:Asgr1 / 11889 MGIID:88081 Length:284 Species:Mus musculus


Alignment Length:133 Identity:26/133 - (19%)
Similarity:46/133 - (34%) Gaps:24/133 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ELNGKCFYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFWFGGNDLQSE 103
            |..|.|::.......|..|...|..:..:|..|::.::    .:::...:|..:.|.|..|  ..
Mouse   159 EYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDE----QNFLQRHMGPLNTWIGLTD--QN 217

  Fly   104 GRFKYISSGKLVRYMGDSNIVEPTQRSNL--------DDCLEIRI--RPNVTVVLDVNCQEKKYF 158
            |.:|::..   ..|........|.|..|.        :||.....  |.|     |..|:....:
Mouse   218 GPWKWVDG---TDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWN-----DDVCRRPYRW 274

  Fly   159 ICE 161
            :||
Mouse   275 VCE 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 24/129 (19%)
Asgr1NP_001278060.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
Endocytosis signal. /evidence=ECO:0000255 5..8
Lectin_N 15..143 CDD:397859
CLECT_DC-SIGN_like 153..278 CDD:153060 26/133 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840901
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.