DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and Asgr1

DIOPT Version :10

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_033844.1 Gene:Asgr1 / 11889 MGIID:88081 Length:284 Species:Mus musculus


Alignment Length:133 Identity:26/133 - (19%)
Similarity:46/133 - (34%) Gaps:24/133 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ELNGKCFYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFWFGGNDLQSE 103
            |..|.|::.......|..|...|..:..:|..|::.::    .:::...:|..:.|.|..|  ..
Mouse   159 EYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDE----QNFLQRHMGPLNTWIGLTD--QN 217

  Fly   104 GRFKYISSGKLVRYMGDSNIVEPTQRSNL--------DDCLEIRI--RPNVTVVLDVNCQEKKYF 158
            |.:|::..   ..|........|.|..|.        :||.....  |.|     |..|:....:
Mouse   218 GPWKWVDG---TDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWN-----DDVCRRPYRW 274

  Fly   159 ICE 161
            :||
Mouse   275 VCE 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 24/129 (19%)
Asgr1NP_033844.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
Lectin_N 4..143 CDD:461106
Endocytosis signal. /evidence=ECO:0000255 5..8
CLECT_DC-SIGN_like 153..278 CDD:153060 26/133 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.