DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and Clec4f

DIOPT Version :10

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_446205.1 Gene:Clec4f / 114598 RGDID:621062 Length:550 Species:Rattus norvegicus


Alignment Length:130 Identity:33/130 - (25%)
Similarity:62/130 - (47%) Gaps:17/130 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 NGKCFYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFWFGGNDLQSEGR 105
            |||.:|....|.:|..|:|.|:.:|.:||.|::.|: :|.:..:|:.|   |.|.|..|..:||.
  Rat   420 NGKFYYFSRDKKSWHEAENFCVSQGAHLASVTSQEE-QAFLVQITNAV---DHWIGLTDQGTEGN 480

  Fly   106 FKYISSGKLVRYMGDSNIVEPTQRSN-------LDDCLEIRIRPNVTVVLDVNCQEKKYFICEQN 163
            :::: .|....|:.........|..|       .:||:.::...|     |:.|.....::|:::
  Rat   481 WRWV-DGTPFDYVQSRRFWRKGQPDNWRHGNGEREDCVHLQRMWN-----DMACGTAYNWVCKKS 539

  Fly   164  163
              Rat   540  539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 31/125 (25%)
Clec4fNP_446205.1 SMC_prok_B <100..390 CDD:274008
CLECT_DC-SIGN_like 414..538 CDD:153060 33/127 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.