DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and LOC108179137

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_017212678.2 Gene:LOC108179137 / 108179137 -ID:- Length:254 Species:Danio rerio


Alignment Length:240 Identity:58/240 - (24%)
Similarity:87/240 - (36%) Gaps:77/240 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 NWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFWFGGNDLQSEGRFK-YISSGKLVR 116
            ||..||..|.....:||.|..|.|...::..| :..|....|.|   ||....:| :.|||..|.
Zfish    29 NWTEAQRYCRENYTDLATVDNMNDMIQLMKSV-NDGGVQKIWIG---LQKTDVYKWHWSSGDPVS 89

  Fly   117 YM----GD---SN---IVEPTQRSNLDDCLEIRIRPNVTVVLDVNCQEKKYFICEQNQMKCAVPA 171
            ::    ||   ||   ::...|.:| :.|...|:         ..|..|..|:   ||:|     
Zfish    90 FLNWTSGDPAGSNECTVMNNGQWAN-EACSNTRV---------FICYNKLVFV---NQLK----- 136

  Fly   172 EDSGDGQKHSHEHLHHFHHD----AGQKDKQ--ETGIKEQSVESDSRP------------ADNSN 218
             :..|.|.:..::    |.|    ..|.:.|  |..|.:::  |...|            :|||.
Zfish   137 -NWTDAQSYCRQN----HIDLVSVRNQNENQQLEKFINDRN--SSGSPVWIGLFRDTWQWSDNST 194

  Fly   219 STEIGVSKEKEAEGAPTPGDGGGTTEPVFENGMENAAEPIAEQEQ 263
            |     |....|:.              |:|..:|||..:.:|.|
Zfish   195 S-----SFRYWADN--------------FKNNGKNAAIQLNKQGQ 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 32/119 (27%)
LOC108179137XP_017212678.2 CLECT_1 19..127 CDD:153072 30/111 (27%)
CLECT 127..236 CDD:321932 28/128 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.