DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and CLEC10A

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_011521915.1 Gene:CLEC10A / 10462 HGNCID:16916 Length:319 Species:Homo sapiens


Alignment Length:164 Identity:34/164 - (20%)
Similarity:60/164 - (36%) Gaps:32/164 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KGPCGKPYLRELNGKCFYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDF 93
            :|.|......|....|::.....::|..|:..|..|..:|..:::.|:    .::|...:|....
Human   180 EGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREE----QNFVQKYLGSAYT 240

  Fly    94 WFGGNDLQSEGRFKYISSGKLVRYMGDSNIVEPTQRSNL--------DDCLEIRIRPNVTVVLDV 150
            |.|.:|  .||.:|::..   ..|.......:|.|..:.        :||  ....|:.....||
Human   241 WMGLSD--PEGAWKWVDG---TDYATGFQNWKPGQPDDWQGHGLGGGEDC--AHFHPDGRWNDDV 298

  Fly   151 NCQEKKYFICEQNQMKCAVPAEDSGDGQKHSHEH 184
             ||...:::||            :|.||.....|
Human   299 -CQRPYHWVCE------------AGLGQTSQESH 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 26/126 (21%)
CLEC10AXP_011521915.1 Lectin_N 18..170 CDD:281887
CLECT_DC-SIGN_like 184..308 CDD:153060 26/135 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150825
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.