DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and LOC103910168

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_021327446.1 Gene:LOC103910168 / 103910168 -ID:- Length:109 Species:Danio rerio


Alignment Length:113 Identity:30/113 - (26%)
Similarity:49/113 - (43%) Gaps:12/113 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 NWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFWFGGNDLQSEGRFKYISSGKLVR- 116
            ||..::..|..:|.:|..:.:.|..:.|..::|.:|.. ..|.|..|.:.||...::.:..|.. 
Zfish     5 NWSESRQYCRDRGEDLLIIKSEEKQRRVTSFITEKVKM-PVWLGLTDAEIEGNMTWVDNSPLNEG 68

  Fly   117 -YMGDSNIVEPTQRSNLDDCLEIRI--RPNVTVVLDVNCQEKKYFICE 161
             :|..    |||....::||:.:..  .||..   ||.|.....||||
Zfish    69 FWMRG----EPTNNDGIEDCVFMNAISSPNWN---DVPCSILARFICE 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 30/113 (27%)
LOC103910168XP_021327446.1 CLECT 2..109 CDD:321932 28/111 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585380
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.