DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and CLEC4M

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_055072.3 Gene:CLEC4M / 10332 HGNCID:13523 Length:399 Species:Homo sapiens


Alignment Length:125 Identity:30/125 - (24%)
Similarity:50/125 - (40%) Gaps:14/125 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GKCFYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFWFGGNDLQSEGRF 106
            |.|:::...:.||..:...|......|..:.|.|:...:....:....|.  |.|.:||..||.:
Human   277 GNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFS--WMGLSDLNQEGTW 339

  Fly   107 KYISSGKL----VRYMGDSNIVEPTQRSNLDDCLEIRIRPNVTVVLDVNCQEKKYFICEQ 162
            :::....|    .||.   |..||....| :||.|.    :.:...|..|....|:||::
Human   340 QWVDGSPLSPSFQRYW---NSGEPNNSGN-EDCAEF----SGSGWNDNRCDVDNYWICKK 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 29/122 (24%)
CLEC4MNP_055072.3 Endocytosis signal. /evidence=ECO:0000250 14..15
transmembrane domain 44..71
7 X approximate tandem repeats 108..269
DUF342 <140..251 CDD:302792
CLECT_DC-SIGN_like 268..391 CDD:153060 30/123 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150809
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.