powered by:
Protein Alignment lectin-46Ca and LOC101885796
DIOPT Version :9
Sequence 1: | NP_652633.1 |
Gene: | lectin-46Ca / 53523 |
FlyBaseID: | FBgn0040093 |
Length: | 328 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_021323879.1 |
Gene: | LOC101885796 / 101885796 |
-ID: | - |
Length: | 264 |
Species: | Danio rerio |
Alignment Length: | 35 |
Identity: | 9/35 - (25%) |
Similarity: | 22/35 - (62%) |
Gaps: | 0/35 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 42 GKCFYVGIKKINWFGAQNNCLRKGLNLADVSTMED 76
|:.:|....|:|||.:::.|:.:|.:|..:::..:
Zfish 217 GQLYYFSTSKLNWFSSRDACVSRGADLVTITSQSE 251
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
lectin-46Ca | NP_652633.1 |
CLECT |
43..162 |
CDD:153057 |
8/34 (24%) |
LOC101885796 | XP_021323879.1 |
CLECT |
5..>40 |
CDD:321932 |
|
CLECT |
211..>252 |
CDD:321932 |
9/35 (26%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1509611at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.