DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and LOC101884526

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_009303560.1 Gene:LOC101884526 / 101884526 -ID:- Length:269 Species:Danio rerio


Alignment Length:154 Identity:35/154 - (22%)
Similarity:70/154 - (45%) Gaps:24/154 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KKQSKKEKDKGPCGKPYLRELNG-KC-----FYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFK 78
            |:::.|...|....:..:.:::| :|     :::..:|.||..::.:|..:|.:|..:.:.|:  
Zfish   127 KEENPKIHQKVEELRKQINKMDGWRCNQSSLYFISSEKKNWTESRRDCKERGADLIIIESKEE-- 189

  Fly    79 AVVHYVTSQVGF-DDFWFGGNDLQSEGRFKYISSGKLVRYMGDSNIVEPTQRS-NLDDCLEIRIR 141
              ..:|..::|. |..|.|..|.:.||.:.:::...|  ..|.....||:..| |.:||.     
Zfish   190 --QEFVEREIGVSDSVWIGLTDSELEGTWTWVNGTSL--SPGFWGAGEPSGTSTNDEDCA----- 245

  Fly   142 PNVTVVL---DVNCQEKKYFICEQ 162
              |.:.|   |..|:....:|||:
Zfish   246 --VNLPLGFGDYPCKNTFKWICER 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 30/128 (23%)
LOC101884526XP_009303560.1 CLECT_DC-SIGN_like 148..267 CDD:153060 31/131 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585381
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.