DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and LOC101884413

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_021327946.1 Gene:LOC101884413 / 101884413 -ID:- Length:292 Species:Danio rerio


Alignment Length:127 Identity:27/127 - (21%)
Similarity:53/127 - (41%) Gaps:19/127 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 FYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFWFGGNDLQSEGRFKYI 109
            ::..:|| :|..::..|...|.:|..::..|:    ..:|......:..|.|.:|...||.:|::
Zfish   180 YFFKLKK-SWTESRRYCRNHGADLVIINNREE----QDFVDKITAGEKAWIGLSDSDVEGSWKWV 239

  Fly   110 SSGKLVRYMGDSNIVEPTQRSNL--DDCLEIRIRPNVTVV---LDVNCQEKKYFICEQNQMK 166
            ...|...::.  :..||:.....  :||:       :||.   .|..|..:..:|||:...|
Zfish   240 DDSKPTSWIW--HYGEPSSGGGQVEEDCV-------LTVTSAWADYPCDAEFQWICEKRVFK 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 25/121 (21%)
LOC101884413XP_021327946.1 SH3_and_anchor <97..174 CDD:275056
CLECT_DC-SIGN_like 170..288 CDD:153060 25/121 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.