DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and clec4m

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_017948020.2 Gene:clec4m / 100497637 XenbaseID:XB-GENE-6043650 Length:225 Species:Xenopus tropicalis


Alignment Length:200 Identity:48/200 - (24%)
Similarity:72/200 - (36%) Gaps:66/200 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IVILTLMTV------HSGCGKKQSKKE---------------------KDKGPCGKPYLRELNGK 43
            |:||||..:      :||...:...||                     ..:..|...: :|.||.
 Frog    43 ILILTLFIMFLSKASNSGASMESKSKEYSELKNNVSVLVYKLKQLEETSQRSNCDSGW-KEFNGS 106

  Fly    44 CFYVGIKKINWFGAQNNCLRKGLNLADVST--MEDFKAVVHYVTSQVGFDD-FWFGGNDLQSEG- 104
            |:|.....:.|..|:..||:|..:||.:::  .:||.    |.|:|   || :|.|.:|...|| 
 Frog   107 CYYFSKSIMGWNKARALCLKKESDLAVITSENEQDFL----YETTQ---DDRYWIGLSDTDQEGA 164

  Fly   105 -----------RFKYISSGKLVRYMGDSNIVEPTQRSNLDDCLEIRIRPNVTVVLDVNCQEKK-Y 157
                       .:|:...|            ||....|.:||..:.......   ||.|.... |
 Frog   165 WVWVDGTDYSTSYKFWKEG------------EPNDHLNNEDCAHMWTHGEWN---DVPCSYSYCY 214

  Fly   158 FICEQ 162
            .|||:
 Frog   215 AICEK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 34/134 (25%)
clec4mXP_017948020.2 CLECT_DC-SIGN_like 96..219 CDD:153060 38/145 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.