DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and LOC100486944

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_031754100.1 Gene:LOC100486944 / 100486944 -ID:- Length:418 Species:Xenopus tropicalis


Alignment Length:237 Identity:42/237 - (17%)
Similarity:83/237 - (35%) Gaps:46/237 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VILTLMTVHSGC--GKKQSKK-------EKDKGPCGKPYLRELNGKCFYVGIKKINWFGAQNNCL 62
            ::|.|......|  |..:|.|       :|:...|...: :..:|.|:|:.....||..|:..|.
 Frog     1 MVLPLHLFSDSCISGAMKSIKQDILQTIQKEIRQCDSGW-KSFDGSCYYIVTTMKNWTEARGFCK 64

  Fly    63 RKGLNLADVSTMEDFKAVVHYVTSQVGFDDFWFGGNDLQSEGRFKYISSGKLVRYMGDSNIV--- 124
            ....:|..:.:..:.|    ::.:......||.|....:::..:::: .|.|      .|:.   
 Frog    65 SMNSDLVIIKSAREQK----FLENITSITKFWIGLTKDRNKNVWRWV-DGTL------HNLSDGF 118

  Fly   125 ----EPTQRSNLDDCLEIRIRPNVTVVLDVNCQEKKYFICEQNQMKCAVPAEDSGDGQKHSHEHL 185
                ||...:..:||:.:.......   ||.|......||.:              |.:.|....
 Frog   119 WYEDEPNNEAGREDCVNLWKDKKWN---DVYCTGLYKAICRK--------------GTRQSDSDS 166

  Fly   186 HHFHHDAGQKDKQE-TGIKEQSVESDSRPADNSNSTEIGVSK 226
            ..:.:..|.|:.:| ...|::|...:..|.....|..:|..:
 Frog   167 DDYENVPGTKEPREMMRFKQESKGENLSPKALKASETLGTQR 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 23/125 (18%)
LOC100486944XP_031754100.1 CLECT_DC-SIGN_like 35..157 CDD:153060 25/136 (18%)
CLECT_DC-SIGN_like 289..412 CDD:153060
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.