DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and reg1b

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_002934628.1 Gene:reg1b / 100485321 XenbaseID:XB-GENE-6043864 Length:162 Species:Xenopus tropicalis


Alignment Length:130 Identity:28/130 - (21%)
Similarity:53/130 - (40%) Gaps:24/130 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 CFYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVV--HYVTSQVGFDDFWFGGNDLQSEGRF 106
            |:.|....:.|..|:..|...|......|.|:|.:|.:  .:|::....:..|.|.:|.:..||:
 Frog    42 CYAVSKNPVPWADAEYECNSYGHGAHLASIMDDAEAAIIGSHVSASQDKEGVWIGLHDPEKNGRW 106

  Fly   107 KYISSGKLVRYMGDSNIVEPTQRSNLDDCLEIRIRPNVTVVL----------DVNCQEKKYFICE 161
            |: :.|.:..:.        ..:|.|.|..:.:   ...|||          ||.|..::.::|:
 Frog   107 KW-TDGSMYNFQ--------AWKSGLPDNAKGK---EFCVVLLGGSKYKKWNDVGCGGRRNYVCK 159

  Fly   162  161
             Frog   160  159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 28/130 (22%)
reg1bXP_002934628.1 CLECT_REG-1_like 31..160 CDD:153064 28/130 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.