DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and dcsignlg

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_002660626.3 Gene:dcsignlg / 100320246 ZFINID:ZDB-GENE-090313-154 Length:263 Species:Danio rerio


Alignment Length:135 Identity:30/135 - (22%)
Similarity:66/135 - (48%) Gaps:20/135 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LRELNGKC--FYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFWFGGND 99
            |:|...|.  |::..:.::|..::..|..:|.:|..:.:.|..:    :::|.|. :|.|.|.:.
Zfish   140 LKEARSKSGWFFMSTEAMSWSESRQFCRDRGADLVIIKSEEKQR----FISSLVK-EDTWIGLSV 199

  Fly   100 LQSEG-RFKYISSGKLVR---YMGDSNIVEPTQRSNLDDCLEIRI---RPNVTVVLDVNCQEKKY 157
            .::.| ::|::.:..|.:   ..|:.|..:..:    :||:|:||   .||..  .|..|.:.:.
Zfish   200 TETGGNKWKWVDNSPLNQGFWAKGEPNNYQGAK----EDCVEVRISQGTPNNW--NDRRCSDSRK 258

  Fly   158 FICEQ 162
            .:||:
Zfish   259 AVCEK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 27/127 (21%)
dcsignlgXP_002660626.3 IncA <40..>144 CDD:282066 2/3 (67%)
Uso1_p115_C 78..>146 CDD:282695 2/5 (40%)
CLECT_DC-SIGN_like 144..263 CDD:153060 27/129 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585377
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.