DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and si:ch211-125e6.11

DIOPT Version :10

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001124136.1 Gene:si:ch211-125e6.11 / 100170830 ZFINID:ZDB-GENE-070912-35 Length:146 Species:Danio rerio


Alignment Length:134 Identity:38/134 - (28%)
Similarity:60/134 - (44%) Gaps:10/134 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GPCGKPYLRELNG-KCFYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDF 93
            |.|  ||.....| ||:....:.::|..|:.||...|.|||.|....:...:::.|.|.   ...
Zfish    20 GSC--PYGWINTGVKCYKFFSQSVSWITAEKNCQGFGGNLASVHNRLENDFLMNMVPSS---SRC 79

  Fly    94 WFGGNDLQSEGRFKYISSGKLVRYMGDSNIVEPTQRSNLDDCLEIRIRPNVTVVLDVNCQEKKYF 158
            |.||:|.:.||::.: :.|.:..|....:.....|||  ::|:||....| ....|..|.....|
Zfish    80 WIGGHDGEQEGQWLW-TDGSMFDYNNWCSDEPNNQRS--ENCMEINWTSN-HCWNDQGCSTSMGF 140

  Fly   159 ICEQ 162
            :||:
Zfish   141 MCER 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 32/118 (27%)
si:ch211-125e6.11NP_001124136.1 CLECT 32..144 CDD:153057 32/118 (27%)

Return to query results.
Submit another query.