DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and illr2

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001121843.1 Gene:illr2 / 100147856 ZFINID:ZDB-GENE-050311-3 Length:253 Species:Danio rerio


Alignment Length:132 Identity:34/132 - (25%)
Similarity:62/132 - (46%) Gaps:19/132 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GKCFYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFWFGGNDLQSEGRF 106
            |||:|....|:||..::::|:.||.:|..:::    ||...::.|::.. ..|.|.||:.:|||:
Zfish   123 GKCYYFSTVKMNWTQSRDHCVTKGGHLVIITS----KAEQDFLASKISV-THWIGLNDMHTEGRW 182

  Fly   107 KYISSGKL-------VRYMGDSNIVEP----TQRSNLDDCLEIRIRPNVTVVL-DVNCQEKKYFI 159
            .::.:..|       ::.:..:|  ||    ......:||..:......|... |..|...|.|:
Zfish   183 VWVDNQPLNKSVEFWMKRVNGNN--EPDNWTKNHPGGEDCACLGHSLGATEFWNDDLCTATKRFV 245

  Fly   160 CE 161
            ||
Zfish   246 CE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 33/131 (25%)
illr2NP_001121843.1 CLECT_DC-SIGN_like 114..247 CDD:153060 32/130 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585394
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2079
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.