Sequence 1: | NP_652633.1 | Gene: | lectin-46Ca / 53523 | FlyBaseID: | FBgn0040093 | Length: | 328 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017210940.1 | Gene: | si:dkey-61f9.1 / 100034385 | ZFINID: | ZDB-GENE-041210-13 | Length: | 364 | Species: | Danio rerio |
Alignment Length: | 201 | Identity: | 38/201 - (18%) |
---|---|---|---|
Similarity: | 69/201 - (34%) | Gaps: | 73/201 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 45 FYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFK--AVVHYVTSQVGFDDFWFGGNDLQSEGRFK 107
Fly 108 YISSGKLVRYMGDSNIVEPTQRSNLDDCLEIRIRPNVT-----VVLDVN-------CQEKKYFIC 160
Fly 161 EQNQMKCAVPAEDSGDG------------------QKHSHEHLHHFHHD--AGQKDKQETGIKEQ 205
Fly 206 SVESDS 211 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lectin-46Ca | NP_652633.1 | CLECT | 43..162 | CDD:153057 | 27/130 (21%) |
si:dkey-61f9.1 | XP_017210940.1 | CLECT | 23..130 | CDD:295302 | 27/139 (19%) |
CLECT | 140..244 | CDD:295302 | 7/51 (14%) | ||
CLECT | 242..363 | CDD:153057 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170585352 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR22802 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.030 |