DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and si:dkey-28d5.7

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_021333340.1 Gene:si:dkey-28d5.7 / 100000161 ZFINID:ZDB-GENE-060503-259 Length:360 Species:Danio rerio


Alignment Length:268 Identity:57/268 - (21%)
Similarity:86/268 - (32%) Gaps:87/268 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 INWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGF-DDFWFG-------GNDLQSEGRFKY 108
            :||..||:.|.:..::|..|....:.:.:..::...:.| .:.|.|       .:| ||...|  
Zfish   139 MNWRDAQSYCRQNHIDLVSVRNQNESQELEKFINDTISFGSEVWIGLFRDPWQWSD-QSNSSF-- 200

  Fly   109 ISSGKLVRYMGDSNIVEPTQRSNLDD---CLEIRIRPNVTVVL-DVNCQEKKY-FICEQNQMKCA 168
                   ||..|          |..|   |  ..|:||..... |.||....| |:|.::::...
Zfish   201 -------RYWAD----------NFKDFAYC--AAIQPNTHGQXGDYNCVSHLYPFVCHEDKLIVI 246

  Fly   169 VPAEDSGDGQKHSHEHLHHFHHDAGQKDKQETGIKEQSVESDSRPAD--NSNSTE---------- 221
            .......:..::..:|    |.|.         :..||||...|..:  ...|||          
Zfish   247 QQNLSWSEALRYCRQH----HVDL---------VSVQSVEMQCRVMNVVKLASTEAVWLGLRHSC 298

  Fly   222 -IG----VSKEKEAEGAPTPGDGGG--TTEPVFENGMENAAEPIAEQEQTVPPGGTGPPAAADAT 279
             :|    ||.|........||:|..  ..||...:|             .|..||       |.|
Zfish   299 ALGIWFWVSGETVCYQNWAPGNGTSEEDCEPTVRSG-------------AVQSGG-------DQT 343

  Fly   280 GAATPAPD 287
            ..:.|..|
Zfish   344 WISRPETD 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 29/122 (24%)
si:dkey-28d5.7XP_021333340.1 CLECT 23..127 CDD:321932
CLECT 130..239 CDD:321932 28/121 (23%)
CLECT 245..357 CDD:153057 28/140 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.