DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and CLEC6A

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001007034.1 Gene:CLEC6A / 93978 HGNCID:14556 Length:209 Species:Homo sapiens


Alignment Length:144 Identity:32/144 - (22%)
Similarity:64/144 - (44%) Gaps:29/144 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 CPLPFSRVGNKCYHVSLQEANWHVADRSCRKLGAELMVLDNQED-----KLLTTTFLKSMGLSFT 83
            ||..:...|:.||.:|.:|..|..::::|.::||.|:|.:.:.:     :.|..:|...:|||..
Human    79 CPASWKSFGSSCYFISSEEKVWSKSEQNCVEMGAHLVVFNTEAEQNFIVQQLNESFSYFLGLSDP 143

  Fly    84 QSWHHSVWAGINCLGNRRTFLLARNGETVPYLN----WVPLEPNNASPEEDCVGFANYN-GAFGY 143
            |..::..|.                 :..||..    |...|||:::  |.|.....:. ..:|:
Human   144 QGNNNWQWI-----------------DKTPYEKNVRFWHLGEPNHSA--EQCASIVFWKPTGWGW 189

  Fly   144 HDIECKVQFPYVCQ 157
            :|:.|:.:...:|:
Human   190 NDVICETRRNSICE 203

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 31/142 (22%)
CLEC6ANP_001007034.1 CLECT_DC-SIGN_like 79..204 CDD:153060 32/144 (22%)
Alpha-D-mannopyranose binding. /evidence=ECO:0000269|PubMed:28652405, ECO:0007744|PDB:5VYB 168..170 1/1 (100%)