DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and REG4

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001152824.1 Gene:REG4 / 83998 HGNCID:22977 Length:158 Species:Homo sapiens


Alignment Length:162 Identity:30/162 - (18%)
Similarity:59/162 - (36%) Gaps:24/162 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IALILECANAQTCPL------PFSRVG-----NKCYHVSLQEANWHVADRSCRKL--GAELMVLD 63
            :.|:|.|. |:|..|      |....|     :.||....:..||..|:..|:..  ||.|..:.
Human     8 LLLLLSCL-AKTGVLGDIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASIL 71

  Fly    64 NQEDKLLTTTFLKSMGLSFTQSWHHSVWAGINCLGNRRTFLLARNGETVPYLNWVPLEPNNASPE 128
            :.::......::.....|      ..:|.|::....|:.:... :|....|.:|   ...:....
Human    72 SLKEASTIAEYISGYQRS------QPIWIGLHDPQKRQQWQWI-DGAMYLYRSW---SGKSMGGN 126

  Fly   129 EDCVGFANYNGAFGYHDIECKVQFPYVCQREP 160
            :.|...::.|....:...||..:..::|:..|
Human   127 KHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 23/145 (16%)
REG4NP_001152824.1 CLECT_REG-1_like 30..156 CDD:153064 22/135 (16%)
Carbohydrate-binding 98..103 0/4 (0%)
Carbohydrate-binding 135..137 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.