DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and asgrl3

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:XP_021332405.1 Gene:asgrl3 / 799269 ZFINID:ZDB-GENE-060526-152 Length:311 Species:Danio rerio


Alignment Length:162 Identity:40/162 - (24%)
Similarity:62/162 - (38%) Gaps:43/162 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LECANAQTCPLPFSRVGNKCYHVSLQEANWHVADRSCRKLGAELM-VLDNQEDKLL------TTT 73
            ||...:.:..:||   ||.||..|..:.||..|...|.:.||.|: :.|:.||:.:      .|.
Zfish   170 LESGCSDSAWVPF---GNSCYLFSRDKMNWTEAKDYCEEKGAWLLKIEDDSEDEWVRNECQFVTD 231

  Fly    74 FLKS----MGLS--FTQSWHHSVWA-GINCLGNRRTFLLARNGETVPYLNWVPLEPNN------A 125
            |...    :||:  .|..|.   || |.|...|:.              :|.|.:|:.      .
Zfish   232 FANPTHYWIGLTDQNTGQWR---WADGTNYTMNKE--------------HWGPGQPDEWTEHSLG 279

  Fly   126 SPEEDCVGFANYNGAFGYHDIECKVQFPYVCQ 157
            ...|||... .|....  :|:.|..:..::|:
Zfish   280 EEGEDCAEI-TYESLL--NDLHCSSKIKFICE 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 37/152 (24%)
asgrl3XP_021332405.1 CLECT_DC-SIGN_like 179..309 CDD:153060 38/153 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585336
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000024
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.