DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and selp

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001230252.1 Gene:selp / 796481 ZFINID:ZDB-GENE-110107-2 Length:868 Species:Danio rerio


Alignment Length:135 Identity:33/135 - (24%)
Similarity:59/135 - (43%) Gaps:13/135 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 YHVSL-QEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKSMGLSFTQSWHHSVWAGINCLGN 99
            ||.:: .:.:|..|.:.|:....:::.:.||.:    ..:|..: |.|.::::   |.||..:..
Zfish    28 YHYNIDSKLDWTAARQWCQTHFTDMVAIQNQAE----IAYLNEI-LPFHRAYY---WIGIRKIDG 84

  Fly   100 RRTFLLARNGETVPYLNWVPLEPNNASPEEDCVGF---ANYNGAFGYHDIECKVQFPYVCQREPA 161
            ..|::..:...||...||...||||....||||..   .|.:.| .::|..|..:...||.....
Zfish    85 HWTWVGTKKRLTVEAANWATNEPNNQGTGEDCVEIYIKRNKDTA-KWNDERCSKKKATVCYLASC 148

  Fly   162 EDYLC 166
            .:..|
Zfish   149 TEISC 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 31/124 (25%)
selpNP_001230252.1 CLECT_selectins_like 26..144 CDD:153062 31/124 (25%)
EGF_CA <153..178 CDD:238011 1/1 (100%)
CCP <200..364 CDD:332582
CCP <324..489 CDD:332582
CCP 521..737 CDD:332582
CCP 751..806 CDD:153056
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.