DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and Clec4a3

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001191170.1 Gene:Clec4a3 / 73149 MGIID:1920399 Length:237 Species:Mus musculus


Alignment Length:154 Identity:41/154 - (26%)
Similarity:64/154 - (41%) Gaps:29/154 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ALILECANAQTCPLPFSRVGNKCYHVSLQ-EANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLK 76
            |.:||......||..:...|:.||..|.. .|:|:.:..:|..:||.|:|:.:||::...|..|.
Mouse    96 ASLLEDKVWSCCPKDWKPFGSYCYFTSTDLVASWNESKENCFHMGAHLVVIHSQEEQDFITGILD 160

  Fly    77 S-----MGLS--FTQSWHHSVWAGINCLGNRRTFLLARNGETVPYLNWVPLEPNNASPEEDCVGF 134
            :     :|||  ..|.|.   |.......:..||             |...||  :|..|.|| .
Mouse   161 TGTAYFIGLSNPGDQQWQ---WIDQTPYDDNTTF-------------WHKGEP--SSDNEQCV-I 206

  Fly   135 ANY--NGAFGYHDIECKVQFPYVC 156
            .|:  :..:|:.||.|..:...:|
Mouse   207 INHRQSTGWGWSDIPCSDKQNSIC 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 38/143 (27%)
Clec4a3NP_001191170.1 DUF2418 41..>82 CDD:287321
CLECT_DC-SIGN_like 107..230 CDD:153060 37/141 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840870
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000024
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.