DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and CLEC3B

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:XP_016862606.1 Gene:CLEC3B / 7123 HGNCID:11891 Length:209 Species:Homo sapiens


Alignment Length:144 Identity:36/144 - (25%)
Similarity:55/144 - (38%) Gaps:14/144 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CANAQTCPLPFSRVGNKCYHVSLQEANWHVADRSCRKLGAEL-MVLDNQEDKLLTTTFLKSMGLS 81
            |.....| |..::|..||:....|...:|.|...|...|..| ......|:..|.....:|:|. 
Human    72 CLGCLVC-LKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGN- 134

  Fly    82 FTQSWHHSVWAGINCLGNRRTFLLARNGETVPYLNW---VPLEPNNASPEEDCVGFANYNGAFGY 143
                 ...:|.|:|.:....|: :...|..:.|.||   :..:|:....|...|.....||.  :
Human   135 -----EAEIWLGLNDMAAEGTW-VDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGK--W 191

  Fly   144 HDIECKVQFPYVCQ 157
            .|..|:.|.||:||
Human   192 FDKRCRDQLPYICQ 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 33/136 (24%)
CLEC3BXP_016862606.1 CLECT_tetranectin_like 78..206 CDD:153066 35/138 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.