DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and Clec4b1

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001177239.1 Gene:Clec4b1 / 69810 MGIID:1917060 Length:209 Species:Mus musculus


Alignment Length:139 Identity:36/139 - (25%)
Similarity:60/139 - (43%) Gaps:18/139 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 CPLPFSRVGNKCYHVS--LQEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKSMGLSFTQSW 86
            ||..:...|:.||.|.  ...|:|:.::.:|.::||.|:|:.:||::...|..|......|...|
Mouse    78 CPKDWKLFGSHCYLVPTVFSSASWNKSEENCSRMGAHLVVIHSQEEQDFITGILDIHAAYFIGLW 142

  Fly    87 H--HSVWAGINCLGNRRTFLLARNGETVPYLNWVPLEPNNASPEEDCVG-FANYNGAFGYHDIEC 148
            .  |..|..::......:.....|||.             :|..|.||. :...|..:|::||.|
Mouse   143 DTGHRQWQWVDQTPYEESVTFWHNGEP-------------SSDNEKCVTVYYRRNIGWGWNDISC 194

  Fly   149 KVQFPYVCQ 157
            .::...|||
Mouse   195 NLKQKSVCQ 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 34/137 (25%)
Clec4b1NP_001177239.1 CLECT_DC-SIGN_like 78..204 CDD:153060 36/139 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840862
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000024
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.