DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and LOC688858

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:XP_038945829.1 Gene:LOC688858 / 688858 RGDID:1584108 Length:207 Species:Rattus norvegicus


Alignment Length:140 Identity:34/140 - (24%)
Similarity:67/140 - (47%) Gaps:22/140 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 CPLPFSRVGNKCYHVSLQEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKSMGLSFTQSWHH 88
            ||..::....:||:.|..:.||:.:..:|:::.|:|:.:::.|::....||||:.|         
  Rat    77 CPWEWTFFHGRCYYFSKSQRNWNDSVAACQEVDAQLVTVESDEEQTFLDTFLKNKG--------- 132

  Fly    89 SVWAGINCLGNRRTFLLARNGETV-----PYLNWVPLEPNNASPEEDCVGFANYNGAFGYHDIEC 148
            ..|.|::.|....|:... :|..:     .|  |:..||||.. .|||.....    .|::|.:|
  Rat   133 PAWMGLSDLKQESTWQWV-DGSPLSDSFRKY--WIKGEPNNQG-NEDCAELRE----DGWNDNKC 189

  Fly   149 KVQFPYVCQR 158
            ..:..::|::
  Rat   190 DNKKFWICKK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 33/137 (24%)
LOC688858XP_038945829.1 CLECT_DC-SIGN_like 77..199 CDD:153060 34/138 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.