DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and Mbl2

DIOPT Version :10

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_073195.2 Gene:Mbl2 / 64668 RGDID:67380 Length:244 Species:Rattus norvegicus


Alignment Length:128 Identity:34/128 - (26%)
Similarity:50/128 - (39%) Gaps:17/128 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VGNKCYHVSLQEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKSMG-LSFTQSWHHSVWAGI 94
            ||.|.:..|::....:.|...|.:|...:....|.|:........|.:. |..|.....:|:..:
  Rat   130 VGKKYFMSSVRRMPLNRAKALCSELQGTVATPRNAEENRAIQNVAKDVAFLGITDQRTENVFEDL 194

  Fly    95 NCLGNRRTFLLARNGETVPYLNWVPLEPNNASPEEDCVGFANYNGAFGYHDIECKVQFPYVCQ 157
            .  |||           |.|.||...||||....|:||.... ||.  ::|:.|...|..||:
  Rat   195 T--GNR-----------VRYTNWNEGEPNNVGSGENCVVLLT-NGK--WNDVPCSDSFLVVCE 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 33/126 (26%)
Mbl2NP_073195.2 Collagen 36..95 CDD:460189
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 43..99
CLECT_collectin_like 132..242 CDD:153061 32/126 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.