DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and Clec10a

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:XP_008766090.1 Gene:Clec10a / 64195 RGDID:621158 Length:307 Species:Rattus norvegicus


Alignment Length:158 Identity:38/158 - (24%)
Similarity:63/158 - (39%) Gaps:45/158 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 CPLPFSRVGNKCYHVSLQEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKS-MGLSFTQSWH 87
            |||.:......||..|.....|..||:.|:...:.|:.:::    |....||:: ||...|    
  Rat   176 CPLHWMEHEGSCYWFSQSGKPWPEADKYCQLENSNLVAVNS----LAEQNFLQTHMGSVVT---- 232

  Fly    88 HSVWAGINCLGNRRTFLLARNGETVP------------YLNWVPLEPNN-----ASPEEDCVGFA 135
               |.|          |..:||   |            :.:|.|.:|:|     ....|||..|.
  Rat   233 ---WIG----------LTDQNG---PWRWVDGTDYEKGFTHWAPKQPDNWYGHGLGGGEDCAHFT 281

  Fly   136 NYNGAFGYHDIECKVQFPYVCQREPAED 163
            : :|.  ::|..|:..:.:||:.:.|:|
  Rat   282 S-DGR--WNDDVCQRPYRWVCEMKLAKD 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 35/150 (23%)
Clec10aXP_008766090.1 Lectin_N 21..166 CDD:281887
Apolipoprotein <63..166 CDD:279749
CLECT_DC-SIGN_like 176..301 CDD:153060 36/151 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344321
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000024
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.