DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and si:dkey-9i23.5

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001139081.1 Gene:si:dkey-9i23.5 / 571862 ZFINID:ZDB-GENE-090313-364 Length:189 Species:Danio rerio


Alignment Length:205 Identity:49/205 - (23%)
Similarity:80/205 - (39%) Gaps:57/205 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GSFGFLLIALI-------LE-------------CANAQTCPLP-FS---RVGNKCYHVSLQEANW 45
            ||.|.||:.|.       :|             |:..:.|.:| ||   |||.:|........|:
Zfish     5 GSIGVLLVLLFGSGNFFKMERGFHAGGVNATEWCSMPKACDVPGFSDWFRVGQRCVKYFFSRLNF 69

  Fly    46 HVADRSCRKL--GAELMVLDNQEDKLLTTTFLKSMGLSFTQSWHHSVWAGINCLGNRRTFLLARN 108
            .:|:..||..  ||.|:.:.|.:|.......:|.......:.|          ||....|   ::
Zfish    70 TLAEFKCRSKAPGAHLVSVHNSQDNNYLLCIVKKFNPKSLRIW----------LGAYEFF---KS 121

  Fly   109 GETV-------PYLNWVPLEPNNA-SPEEDCVGFANYNGAFGYHDIECKVQFPYVCQREPAEDYL 165
            ||..       .:..|||.|||:. :..|:|:.. |:..|..::|.:|.|:..::|         
Zfish   122 GEFFWLDGSFWNFNRWVPGEPNHMYTSNEECLEM-NWKEAGKWNDDKCNVRKSFIC--------- 176

  Fly   166 CLKRDLFLKV 175
            ..||..|:::
Zfish   177 AFKRKEFMEI 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 37/146 (25%)
si:dkey-9i23.5NP_001139081.1 CLECT 58..176 CDD:153057 30/131 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I5404
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X59
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.070

Return to query results.
Submit another query.