DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and si:ch211-282j17.3

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001025393.1 Gene:si:ch211-282j17.3 / 568449 ZFINID:ZDB-GENE-041210-287 Length:370 Species:Danio rerio


Alignment Length:131 Identity:36/131 - (27%)
Similarity:57/131 - (43%) Gaps:17/131 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 CYHVSL------QEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKSMGLSFTQSWHHSVWAG 93
            ||:.:.      |..||..|...||:...:|:.:.||.:......|:.....|.:     :||.|
Zfish   132 CYNTNTGLVFVDQLMNWRAAQSYCRQNHIDLVSVRNQNESQQLEKFINDRNSSGS-----AVWIG 191

  Fly    94 INCLGNRRTFLLARNGETVPYLNWVPLEPNNASPEEDCVGFANYNGAFGYHDIECKVQFPYVCQR 158
            :    .|.|:..:....: .:..|...|||||...::|:|. |.|....:|||.|...||:||..
Zfish   192 L----FRDTWQWSDQSNS-SFRYWNTAEPNNAGGIQNCIGM-NQNAQGRWHDISCTGSFPFVCHE 250

  Fly   159 E 159
            :
Zfish   251 D 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 35/127 (28%)
si:ch211-282j17.3NP_001025393.1 CLECT 24..134 CDD:295302 1/1 (100%)
CLECT_1 139..249 CDD:153072 33/120 (28%)
CLECT 255..367 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.