DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and Clec4e

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_064332.1 Gene:Clec4e / 56619 MGIID:1861232 Length:214 Species:Mus musculus


Alignment Length:142 Identity:34/142 - (23%)
Similarity:54/142 - (38%) Gaps:23/142 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 CPLPFSRVGNKCYHVSLQEANWHVADRSCRKLGAELMVLDNQEDK---LLTTTFLKSMGLSFTQS 85
            |||.:....:.||..|.....|..:.::|..:||.|:|:|.||::   ..|....|...:..|..
Mouse    80 CPLNWKHYQSSCYFFSTTTLTWSSSLKNCSDMGAHLVVIDTQEEQEFLFRTKPKRKEFYIGLTDQ 144

  Fly    86 WHHSVWAGINCLGNRRTFLLARNGETVPYLN----WVPLEPNNASPEEDCVGFA-NYNGAFGYHD 145
            .....|..:               :..|:..    |...||||....|||.... :.|....::|
Mouse   145 VVEGQWQWV---------------DDTPFTESLSFWDAGEPNNIVLVEDCATIRDSSNSRKNWND 194

  Fly   146 IECKVQFPYVCQ 157
            |.|....|::|:
Mouse   195 IPCFYSMPWICE 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 33/140 (24%)
Clec4eNP_064332.1 CLECT_DC-SIGN_like 80..207 CDD:153060 34/142 (24%)
Confers specificity for glucose/mannose-type carbohydrates. /evidence=ECO:0000250|UniProtKB:Q9ULY5 169..171 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840948
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000024
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.