DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and lectin-46Cb

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001163102.1 Gene:lectin-46Cb / 53522 FlyBaseID:FBgn0040092 Length:322 Species:Drosophila melanogaster


Alignment Length:114 Identity:37/114 - (32%)
Similarity:52/114 - (45%) Gaps:14/114 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 CPLPF-SRVGNKCYHVSLQEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKSMGLSFTQSWH 87
            ||..: .|:..|||:.|:::.||..|..:|.:.|..|..|.||.|......||.  ||..|:.: 
  Fly    27 CPRRYLRRINGKCYYFSVKKMNWFGALNNCLRKGLTLADLSNQRDFDGAIGFLS--GLGNTEDF- 88

  Fly    88 HSVWAGINCLGNRRTFLLARNGETVPYL----NWVPLEPNNASPEEDCV 132
               |.|.|.|.:...|....||..|.|.    |.:|||.:..   :||:
  Fly    89 ---WFGGNDLYHEGRFQYISNGRLVRYYSNYSNVLPLEHSEC---DDCL 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 37/114 (32%)
lectin-46CbNP_001163102.1 CLECT 38..155 CDD:153057 34/103 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448944
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.