DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and CLEC4A

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_057268.1 Gene:CLEC4A / 50856 HGNCID:13257 Length:237 Species:Homo sapiens


Alignment Length:163 Identity:39/163 - (23%)
Similarity:65/163 - (39%) Gaps:31/163 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIALILECANA---------QTCPLPFSRVGNKCYHVSLQEANWHVADRSCRKLGAELMVLDNQE 66
            |:...|||...         ..||..:....:.||.:|.:.|:|..:::.|.::.|.|:|::.||
Human    84 LVHTTLECVKKNMPVEETAWSCCPKNWKSFSSNCYFISTESASWQDSEKDCARMEAHLLVINTQE 148

  Fly    67 DKLLTTTFLKS-----MGLSFTQSWHHSVWAGINCLGNRRTFLLARNGETVPYLNWVPLEPNNAS 126
            ::......|:.     :|||..:...|..|..........||             |.|.||::  
Human   149 EQDFIFQNLQEESAYFVGLSDPEGQRHWQWVDQTPYNESSTF-------------WHPREPSD-- 198

  Fly   127 PEEDCV--GFANYNGAFGYHDIECKVQFPYVCQ 157
            |.|.||  .|......:|::|:.|......||:
Human   199 PNERCVVLNFRKSPKRWGWNDVNCLGPQRSVCE 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 34/139 (24%)
CLEC4ANP_057268.1 ITIM motif. /evidence=ECO:0000269|PubMed:20530286 5..10
CLECT_DC-SIGN_like 106..232 CDD:153060 35/141 (25%)
Mannose binding. /evidence=ECO:0000269|PubMed:27015765, ECO:0007744|PDB:5B1X 195..197 1/1 (100%)
N-acetyl-D-glucosamine binding. /evidence=ECO:0000269|PubMed:27015765, ECO:0007744|PDB:5B1X 207..209 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150836
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I5451
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000024
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.