DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and CD207

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_056532.4 Gene:CD207 / 50489 HGNCID:17935 Length:328 Species:Homo sapiens


Alignment Length:136 Identity:34/136 - (25%)
Similarity:53/136 - (38%) Gaps:24/136 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 YHVSLQEANWHVADRSCRKLGAEL-MVLDNQEDKLLTTTFLKSMGLSFTQSWHHSVWAGINCLGN 99
            |:.||....|:.|::.|....:.| .|....|.:.|..|   :.||.:        |.|:...|.
Human   207 YYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKT---AGGLIY--------WIGLTKAGM 260

  Fly   100 RRTFLLARNGETVPYLN------WVPLEPNNASPEEDCVGFANYNGAFGYHDIECKVQFPYVCQR 158
            ...:...   :..|:..      |:|.|||||...|.| |.........::|..|...|.::|:|
Human   261 EGDWSWV---DDTPFNKVQSVRFWIPGEPNNAGNNEHC-GNIKAPSLQAWNDAPCDKTFLFICKR 321

  Fly   159 E--PAE 162
            .  |:|
Human   322 PYVPSE 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 30/127 (24%)
CD207NP_056532.4 CLECT_DC-SIGN_like 196..321 CDD:153060 31/128 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150856
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000024
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.