DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and CD207

DIOPT Version :10

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_056532.4 Gene:CD207 / 50489 HGNCID:17935 Length:328 Species:Homo sapiens


Alignment Length:136 Identity:34/136 - (25%)
Similarity:53/136 - (38%) Gaps:24/136 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 YHVSLQEANWHVADRSCRKLGAEL-MVLDNQEDKLLTTTFLKSMGLSFTQSWHHSVWAGINCLGN 99
            |:.||....|:.|::.|....:.| .|....|.:.|..|   :.||.:        |.|:...|.
Human   207 YYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKT---AGGLIY--------WIGLTKAGM 260

  Fly   100 RRTFLLARNGETVPYLN------WVPLEPNNASPEEDCVGFANYNGAFGYHDIECKVQFPYVCQR 158
            ...:...   :..|:..      |:|.|||||...|.| |.........::|..|...|.::|:|
Human   261 EGDWSWV---DDTPFNKVQSVRFWIPGEPNNAGNNEHC-GNIKAPSLQAWNDAPCDKTFLFICKR 321

  Fly   159 E--PAE 162
            .  |:|
Human   322 PYVPSE 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 30/127 (24%)
CD207NP_056532.4 CwlO1 86..>197 CDD:443091
CLECT_DC-SIGN_like 196..321 CDD:153060 31/128 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.