DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and Cd207

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:XP_578352.4 Gene:Cd207 / 502852 RGDID:1565913 Length:332 Species:Rattus norvegicus


Alignment Length:143 Identity:27/143 - (18%)
Similarity:47/143 - (32%) Gaps:41/143 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VGNKCYHVSLQEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKSMGLSFTQSWHHSVWAGIN 95
            :|| .|:.|.....|:.|::.|....|.|..:.::.:.    .||..:......      |.|:.
  Rat   207 MGN-FYYFSRTPKTWYSAEQYCISRKAHLTSVSSESEH----EFLYKVADGIPH------WIGLT 260

  Fly    96 CLGNR----------------RTFLLARNGETVPYLNWVPLEPNNASPEEDCVGFANYNGAFGYH 144
            ..|:.                |.|             |:|.||||....|.|... ..:....::
  Rat   261 KAGSEGDWYWVDQTSFNKEQSRRF-------------WIPGEPNNVRNNEHCANI-RVSALKCWN 311

  Fly   145 DIECKVQFPYVCQ 157
            |..|...:.::|:
  Rat   312 DSPCDNVYSFICK 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 26/141 (18%)
Cd207XP_578352.4 DUF881 127..>190 CDD:303034
CLECT_DC-SIGN_like 202..325 CDD:153060 27/143 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344373
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000024
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.