DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and Cd209e

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:XP_006248837.1 Gene:Cd209e / 501797 RGDID:1563333 Length:215 Species:Rattus norvegicus


Alignment Length:194 Identity:38/194 - (19%)
Similarity:77/194 - (39%) Gaps:65/194 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FGFLLIALILECAN-------------------------------AQTCPLPFSRVGNKCYHVSL 40
            |..||:|::::.:.                               .:.||..::.....||..|.
  Rat    37 FAGLLVAIVIQVSKIPSSEEVQWEQTKQEKMYQDLSQLKSEIDSLCRLCPWDWTFFNGNCYFFSK 101

  Fly    41 QEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKSMGLSFTQSWHHSVWAGINCLGNRRTFLL 105
            .:.:||.:..:|:::.|:|:.:.:.|::    :||:.     |...:...|.|::.|.       
  Rat   102 SQRDWHNSITACQEMEAQLVTIKSPEEQ----SFLQQ-----TSKKNGYTWMGLSDLN------- 150

  Fly   106 ARNGETVPYLNWVPL-----------EPNNASPEEDCVGFANYNGAFGYHDIECKVQFPYVCQR 158
             :.||.. :|:..||           :|||.. .:|||.|.|    .|::|.:|.....::|::
  Rat   151 -KEGEWY-WLDGSPLSDSLRNYWNEGQPNNID-GQDCVEFRN----DGWNDAKCDNWKFWICKK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 33/143 (23%)
Cd209eXP_006248837.1 CLECT_DC-SIGN_like 85..207 CDD:153060 34/144 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344352
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000024
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X59
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.