DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and Clec4a4

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001005860.1 Gene:Clec4a4 / 474145 MGIID:3624119 Length:236 Species:Mus musculus


Alignment Length:169 Identity:41/169 - (24%)
Similarity:68/169 - (40%) Gaps:43/169 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 CIKGSFGFLLIALILECANAQTCPLPFSRVGNKCYHV-SLQEANWHVADRSCRKLGAELMVLDNQ 65
            |||.  |.|:...:..|     ||..:....:.||.: :..:|:|:.::..|..:||.|:|:.:|
Mouse    92 CIKN--GSLMEDKVWSC-----CPKDWKPFVSHCYFILNDSKASWNESEEKCSHMGAHLVVIHSQ 149

  Fly    66 -EDKLLTTTFLKSMGLSFTQSWHHSVWAGINCLGNRRTFLLARNGETVPYLNWVPLEPNNAS--- 126
             |...:|:....|.|          .:.|:...|.|:             ..|:...|.|.|   
Mouse   150 AEQDFITSNLNTSAG----------YFIGLLDAGQRQ-------------WRWIDQTPYNKSATF 191

  Fly   127 -----PEED---CVGFANYNGAFGYHDIECKVQFPYVCQ 157
                 |.:|   ||...:....:|::||.||.:...|||
Mouse   192 WHKGEPNQDWERCVIINHKTTGWGWNDIPCKDEHNSVCQ 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 33/145 (23%)
Clec4a4NP_001005860.1 CLECT_DC-SIGN_like 107..230 CDD:153060 33/145 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840866
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000024
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.