DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and Clec4e

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001005897.2 Gene:Clec4e / 450223 RGDID:1359298 Length:215 Species:Rattus norvegicus


Alignment Length:156 Identity:34/156 - (21%)
Similarity:57/156 - (36%) Gaps:25/156 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IALILECANA--QTCPLPFSRVGNKCYHVSLQEANWHVADRSCRKLGAELMVL---DNQEDKLLT 71
            ::..||.:.:  ..|||.:....:.||..|.....|..:..:|..:||.|:|:   :.||....|
  Rat    67 LSCYLEASGSVKNCCPLNWKHFQSSCYFFSTTTLTWPSSLNNCSDMGAHLVVINTWEEQEFLFRT 131

  Fly    72 TTFLKSMGLSFTQSWHHSVWAGINCLGNRRTFLLARNGETVPYLN----WVPLEPNNASPEEDCV 132
            ....|...:..|.......|..:               :..|:..    |...||||....|||.
  Rat   132 KPRKKEFYIGLTDQVVEGQWRWV---------------DDTPFTESLSFWDAGEPNNIVFVEDCA 181

  Fly   133 GFA-NYNGAFGYHDIECKVQFPYVCQ 157
            ... :.|....::|:.|....|::|:
  Rat   182 TMRDSSNPRKNWNDVSCFFSMPWICE 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 31/140 (22%)
Clec4eNP_001005897.2 CLECT_DC-SIGN_like 81..208 CDD:153060 32/142 (23%)
Confers specificity for glucose/mannose-type carbohydrates. /evidence=ECO:0000250|UniProtKB:Q9ULY5 170..172 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344365
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000024
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X59
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.