DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and Clec4b2

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001005896.2 Gene:Clec4b2 / 450222 RGDID:1359354 Length:208 Species:Rattus norvegicus


Alignment Length:158 Identity:41/158 - (25%)
Similarity:65/158 - (41%) Gaps:27/158 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SFGFLLIALILECANAQTCPLPFSRVGNKCYHVSLQEANWHVADRSCRKLGAELMVLDNQEDK-- 68
            |.|.::...:..|     ||..:...|:.||..:...|||:.:...|..:||.|:|:.:||::  
  Rat    66 SDGTMVSGKVWSC-----CPKDWKSFGSHCYFTTDFVANWNESKEKCSHMGAHLLVIHSQEEQDF 125

  Fly    69 ---LLTTTFLKSMGLSFTQSWHHSVWAGINCLGNRRTFLLARNGETVPYLNWVPLEPNNASPEED 130
               :|.|.:....||| .|..:...|..........||             |...||||  ..|.
  Rat   126 INGILDTRWGYFTGLS-DQGQNQWQWIDQTPYNESVTF-------------WHEDEPNN--DYEK 174

  Fly   131 CVGFANYNG-AFGYHDIECKVQFPYVCQ 157
            ||...::.. .:|::||.|..:...:||
  Rat   175 CVEINHHKDIGWGWNDIVCSSEHKSICQ 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 36/138 (26%)
Clec4b2NP_001005896.2 CLECT_DC-SIGN_like 79..202 CDD:153060 36/138 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344273
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000024
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X59
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.