DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and Reg4

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001004096.1 Gene:Reg4 / 445583 RGDID:1303341 Length:157 Species:Rattus norvegicus


Alignment Length:150 Identity:30/150 - (20%)
Similarity:60/150 - (40%) Gaps:32/150 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 TCPLPFSRVGNKCYHVSLQEANWHVADRSCRKL--GAEL-MVLDNQEDKLLT---TTFLKSMGLS 81
            :|...:....:.||....:..||..|:..|:..  |:.| .||:.:|..:::   |.:.:|:   
  Rat    28 SCASGWFNYRSHCYGYFRKLRNWSHAELECQSYGNGSHLASVLNPKEASVISKYITGYQRSL--- 89

  Fly    82 FTQSWHHSVWAGINCLGNRRTFLLARNGETVPYLNWVPLEPNNA------SPEEDCVGFANYNGA 140
                   .||.|::......::... :|.|..|..|.|...:.|      :|::..:.: |.|| 
  Rat    90 -------PVWIGLHDPQKNASWQWI-DGSTNQYRPWSPRTKSEARHCTEMNPKDKFLTW-NKNG- 144

  Fly   141 FGYHDIECKVQFPYVCQREP 160
                   |..:..::|:..|
  Rat   145 -------CTKRQHFLCKYRP 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 28/144 (19%)
Reg4NP_001004096.1 CLECT_REG-1_like 29..155 CDD:153064 29/145 (20%)
Carbohydrate-binding. /evidence=ECO:0000250 97..101 0/3 (0%)
Carbohydrate-binding. /evidence=ECO:0000250 134..136 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X59
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.