DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and ASGR1

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001662.1 Gene:ASGR1 / 432 HGNCID:742 Length:291 Species:Homo sapiens


Alignment Length:145 Identity:36/145 - (24%)
Similarity:61/145 - (42%) Gaps:27/145 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 CPLPFSRVGNKCYHVSLQEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKSMGLSFTQSWHH 88
            ||:.:......||..|.....|..||..||...|.|:|:.:.|::            .|.|  ||
Human   154 CPVNWVEHERSCYWFSRSGKAWADADNYCRLEDAHLVVVTSWEEQ------------KFVQ--HH 204

  Fly    89 ----SVWAGINCLGNRRTFLLARNGETVPYLNWVPLEPNN-----ASPEEDCVGFANYNGAFGYH 144
                :.|.|::.......::...:.|| .:.||.|.:|::     ....|||..|.: :|.  ::
Human   205 IGPVNTWMGLHDQNGPWKWVDGTDYET-GFKNWRPEQPDDWYGHGLGGGEDCAHFTD-DGR--WN 265

  Fly   145 DIECKVQFPYVCQRE 159
            |..|:..:.:||:.|
Human   266 DDVCQRPYRWVCETE 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 34/141 (24%)
ASGR1NP_001662.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
Endocytosis signal. /evidence=ECO:0000255 5..8
Lectin_N 17..144 CDD:309178
CLECT_DC-SIGN_like 154..279 CDD:153060 35/142 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150820
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000024
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.