DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and CG14866

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001138057.1 Gene:CG14866 / 41854 FlyBaseID:FBgn0038315 Length:455 Species:Drosophila melanogaster


Alignment Length:178 Identity:41/178 - (23%)
Similarity:68/178 - (38%) Gaps:54/178 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 CPLPFSRVGNKCYHV-SLQEANWHVADRSCRKLGAEL----MVLDNQEDKLLTTTFLKSMGLSFT 83
            ||..|:|:.:.||:: |.|:.||..|:.:|:.|.:.|    .|.:|:|          .|.....
  Fly   271 CPANFTRISDNCYYINSQQQVNWKTANSACKGLNSHLAEFEKVSENEE----------IMAYLLN 325

  Fly    84 QSWHHS--------------VWAG----INCLGNRRTFLLARNGETVPYLNWVPLEPNNASPE-- 128
            |..|..              :|:.    :|...|..:..:|:.||.....|.|. ....|:.|  
  Fly   326 QPTHRGRDYWLGGLNPGLLWIWSNSAKPVNPNMNLTSIAMAQKGENSTAANLVD-SSEQAAEEAT 389

  Fly   129 -ED-------------CVGFANYNG---AFGYHDIECKVQFPYVCQRE 159
             ||             |:.. :||.   ::.|:..||..:..|:|:.|
  Fly   390 GEDVLNNTVQIEGKGRCLRL-SYNAGKHSYVYYGQECTSRHYYICEHE 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 39/174 (22%)
CG14866NP_001138057.1 CLECT 271..434 CDD:214480 39/174 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454802
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.