DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and CG34033

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001033937.1 Gene:CG34033 / 3885602 FlyBaseID:FBgn0054033 Length:168 Species:Drosophila melanogaster


Alignment Length:162 Identity:36/162 - (22%)
Similarity:63/162 - (38%) Gaps:27/162 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FLLIALILECANAQTCPLPFSRVGNKCYHVSLQEANWHVADRSCRKLGAELMVLDNQEDKLLTTT 73
            :||:.|..:.||.:          ..|.:.|.:.|:|..|...|:.|  .:.:.|     |.|..
  Fly    14 WLLLLLRADEANGK----------GICLYFSEKTASWFSALTICKSL--HMCLAD-----LNTEV 61

  Fly    74 FLKSMGLSFTQSWHHSVWAGINCLGNRRTFLLARNGETVPYLNWVPLEPNNAS--PEEDCVGFAN 136
            .|..|.....|. .|..|.|:|. .::.|:....|.:::.|      .|:|:.  ..|.||....
  Fly    62 TLFQMKSKINQD-DHEYWFGLNA-HDKPTYRYVSNNKSIEY------SPHNSKLVNNEGCVYVKQ 118

  Fly   137 YNGAFGYHDIECKVQFPYVCQREPAEDYLCLK 168
            .|..|.:...:|:....::|.:....|.:.:|
  Fly   119 QNDFFKFESAKCREHRRFICTKTDECDGVSMK 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 28/134 (21%)
CG34033NP_001033937.1 CLECT 30..140 CDD:153057 29/124 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448943
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.