DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and tfc

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster


Alignment Length:158 Identity:41/158 - (25%)
Similarity:68/158 - (43%) Gaps:19/158 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ECAN----AQTCP----LPFSRVGNKCYHVSL-QEANWHVADRSCRKLGAELMVLDNQEDKLLTT 72
            :|.|    :|..|    :|..::|.|.|::.: .:|||..|.:.||..|..|..:.:||:.....
  Fly   223 DCPNCVDESQYTPNKWTMPLLKLGEKRYYLGIFFKANWFKATQYCRYHGMHLASISSQEENDRLE 287

  Fly    73 TFLKSMGLSFTQSWHHSVWAGINCLGNRRTFLLARNGETVPYLNWVPLEPNN----ASPEEDCVG 133
            ..::..||.     |...|.....|.:...|.....|..:.:.||...||||    ...||:|:.
  Fly   288 KHIRDFGLG-----HEHFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLE 347

  Fly   134 FANYNG-AFGYHDIECKVQFPYVCQREP 160
            ..|.:| ...::|..|..:..:||:.:|
  Fly   348 LWNRDGKGLKWNDSPCSFETYFVCEVQP 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 36/142 (25%)
tfcNP_612091.1 CLECT 249..373 CDD:153057 33/128 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454806
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.