DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and nw

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001027435.2 Gene:nw / 3772015 FlyBaseID:FBgn0283508 Length:491 Species:Drosophila melanogaster


Alignment Length:154 Identity:38/154 - (24%)
Similarity:57/154 - (37%) Gaps:38/154 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FLLIALILECANAQTCPLPFSRVGNKCYHVSLQ-----EANWHVADRSCRKLGAELMVLDNQEDK 68
            |.|::| |.||..|.  :....:....|.:|..     |.|:.:|.:.||.||.:|...:.:|..
  Fly     7 FCLLSL-LACAAGQR--ITTIHLDGVQYFISRMNPYSPELNYFLAYQYCRSLGLQLASFETKEKA 68

  Fly    69 LLTTTFLKSMGLSFTQSWHHSVWAGINCLGN------------RRTFLLARNGETVPYLNWV-PL 120
            ...||:||:.|..     ::..|...|.||.            ..||....|.........: |:
  Fly    69 ESMTTYLKNAGYG-----NYDFWTSGNRLGTGMFLWMSTGLPFNATFDFFENSADAIQAGLLDPV 128

  Fly   121 EPN-NASP-----------EEDCV 132
            :.| |.||           |:.||
  Fly   129 DHNSNTSPQRTARDSSSGAEKGCV 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 31/139 (22%)
nwNP_001027435.2 CLECT 31..176 CDD:153057 31/127 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.