DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and Cd209

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001102319.1 Gene:Cd209 / 363856 RGDID:1561104 Length:237 Species:Rattus norvegicus


Alignment Length:189 Identity:47/189 - (24%)
Similarity:80/189 - (42%) Gaps:64/189 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GFLLIALIL-------ECAN-----------------AQTCPLPFSRVGNKCYHVSLQEANWHVA 48
            |.|||.|:|       |..:                 .|.||..::.....||..|..:.|||.:
  Rat    66 GLLLIILVLVSKVPSSEVQDKIYQELMQLKTEVHDGLCQPCPRDWTFFNGSCYFFSKSQRNWHNS 130

  Fly    49 DRSCRKLGAELMVLDNQEDKLLTTTFLKSMGLSFTQSWHHSVWAGINCLGNRRTFLLARNGETVP 113
            ..:|::|||:|::::..|::    |||:.     |.......|.|::.:.|..|:          
  Rat   131 ITACKELGAQLVIVETDEEQ----TFLQQ-----TSKTRGPTWMGLSDMHNEATW---------- 176

  Fly   114 YLNWV---PL-----------EPNNASPEEDCVGFANYNGAFGYHDIECKVQFPYVCQR 158
              :||   ||           ||||.. :|||   |.::|. |::|:.|..:..::|::
  Rat   177 --HWVDGSPLSPSFAQYWNRGEPNNVG-DEDC---AEFSGD-GWNDLRCDTRIFWICKK 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 38/146 (26%)
Cd209NP_001102319.1 CLECT_DC-SIGN_like 106..228 CDD:153060 39/147 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344348
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I5284
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000024
OrthoInspector 1 1.000 - - otm46266
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X59
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.990

Return to query results.
Submit another query.