DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and Clec4a3

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001005891.1 Gene:Clec4a3 / 362431 RGDID:1359528 Length:237 Species:Rattus norvegicus


Alignment Length:164 Identity:36/164 - (21%)
Similarity:61/164 - (37%) Gaps:44/164 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LECANAQT---------CPLPFSRVGNKCYHVSLQEA-NWHVADRSCRKLGAELMVLDNQEDKLL 70
            |||....:         ||..:....:.||..|.... :|..::..|..:||.|:|:.:||::..
  Rat    90 LECTKWDSLLEDKVWSCCPKDWKPFDSNCYFPSTDSVESWMESEEKCSGIGAHLVVIHSQEEQDF 154

  Fly    71 TTTFLKSMGLSFTQSWHHSVWAGINCLGNRRTFLLARNGETVPYLNWVPLEPNN----------- 124
            ....|.:         |.:.:.|::..|:|:             ..||...|.|           
  Rat   155 LPRILDT---------HAAYFIGLSDPGHRQ-------------WQWVDQTPYNGNATFWHEGEP 197

  Fly   125 ASPEEDCVGFANY-NGAFGYHDIECKVQFPYVCQ 157
            :|..|.||...:: |..:|:.|..|..:...|||
  Rat   198 SSDNEQCVIINHHENTGWGWSDSSCSDKQKLVCQ 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 31/145 (21%)
Clec4a3NP_001005891.1 CLECT_DC-SIGN_like 107..231 CDD:153060 31/145 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344285
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000024
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X59
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.