DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and CLEC4G

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_940894.1 Gene:CLEC4G / 339390 HGNCID:24591 Length:293 Species:Homo sapiens


Alignment Length:162 Identity:34/162 - (20%)
Similarity:65/162 - (40%) Gaps:26/162 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIALILECANAQTCPLPFSRVGNKCYHVSLQEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFL 75
            |.|:.|:..:.:.||..:......||..|:.:..|..|...|....|.|:::...:::...|...
Human   152 LEAVRLQNNSCEPCPTSWLSFEGSCYFFSVPKTTWAAAQDHCADASAHLVIVGGLDEQGFLTRNT 216

  Fly    76 KSMGLSFTQSWHHSVWAGINC---LGNRRTFLLARNGETVPYLNWVPLEPNNASPEEDCVGFANY 137
            :..|          .|.|:..   ||..:.:... :|.::.:.:|...|||:|...|:|| ...:
Human   217 RGRG----------YWLGLRAVRHLGKVQGYQWV-DGVSLSFSHWNQGEPNDAWGRENCV-MMLH 269

  Fly   138 NGAFGYHDIECKVQFPYVCQREPAEDYLCLKR 169
            .|.  ::|..|..:         .:.::|.||
Human   270 TGL--WNDAPCDSE---------KDGWICEKR 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 28/135 (21%)
CLEC4GNP_940894.1 ATG16 63..>156 CDD:312208 2/3 (67%)
CLECT 165..289 CDD:321932 29/146 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150840
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.