DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and lectin-37Da

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster


Alignment Length:143 Identity:41/143 - (28%)
Similarity:62/143 - (43%) Gaps:13/143 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PFSRVGNKCYHVSLQEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKSMGLSFTQSWHHSVW 91
            ||.::....|.....:.||:||..:||:|.:||:..:..|:......||.:.|   .:|.|   |
  Fly    42 PFIKINESYYVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAIAAFLNARG---DRSEH---W 100

  Fly    92 AGINCLGNRRTFLLARNGETVPYLNWVPLEPNNASPEEDCV--GFA-NYNGAFGYHDIEC----K 149
            ...|.||...|.....|.:.|....|.|.:|:||...|.|:  |:. .|:..|..:|..|    .
  Fly   101 TSGNDLGKTGTHYWFSNAQLVTIKRWAPKQPDNAGGREHCIHLGYIYGYSTEFQLNDRPCHNHAS 165

  Fly   150 VQFPYVCQREPAE 162
            ..|.|:|:....|
  Fly   166 SLFKYICEAPKQE 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 39/136 (29%)
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 37/129 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.