DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and lectin-37Db

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001014490.1 Gene:lectin-37Db / 3346221 FlyBaseID:FBgn0053533 Length:150 Species:Drosophila melanogaster


Alignment Length:155 Identity:48/155 - (30%)
Similarity:73/155 - (47%) Gaps:19/155 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIALILECANAQTCPLPFSRVGN--------KCYHVSLQEANWHVADRSCRKLGAELMVLDNQED 67
            |:.|.|.|.:|  .||..|.:||        |.|::||.:.||..|...||:.|..|:.|:::|:
  Fly     5 LLLLFLVCWSA--LPLESSPLGNRYNLEIGEKQYYISLAKTNWFEASNHCRQNGGFLLNLESREE 67

  Fly    68 KLLTTTFLKSMGLSFTQSWHHSVWAGINCLGNRRTFLLARNGETVPYLNWVPLEPNNASPEEDCV 132
            ..|.:..|...         :|.|..||.||.|..::....|...|:|||...||:|:|..:.||
  Fly    68 LELLSPHLHPA---------YSYWLSINDLGERGVYVSEATGLEAPFLNWSAGEPDNSSGYDRCV 123

  Fly   133 GFANYNGAFGYHDIECKVQFPYVCQ 157
            .......:|..:|:.|.....::||
  Fly   124 ELWLSTTSFQMNDLPCYSSVAFICQ 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 41/140 (29%)
lectin-37DbNP_001014490.1 CLECT 34..148 CDD:153057 36/122 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46266
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.